CAPZA1 (NM_006135) Human Recombinant Protein
CAT#: TP301642
Recombinant protein of human capping protein (actin filament) muscle Z-line, alpha 1 (CAPZA1), 20 µg
View other "CAPZA1" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201642 protein sequence
Red=Cloning site Green=Tags(s) MADFDDRVSDEEKVRIAAKFITHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAQYNMDQFTPVKIEGY EDQVLITEHGDLGNSRFLDPRNKISFKFDHLRKEASDPQPEEADGGLKSWRESCDSALRAYVKDHYSNGF CTVYAKTIDGQQTIIACIESHQFQPKNFWNGRWRSEWKFTITPPTAQVVGVLKIQVHYYEDGNVQLVSHK DVQDSLTVSNEAQTAKEFIKIIENAENEYQTAISENYQTMSDTTFKALRRQLPVTRTKIDWNKILSYKIG KEMQNA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 32.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006126 |
Locus ID | 829 |
UniProt ID | P52907 |
Refseq Size | 2758 |
Cytogenetics | 1p13.2 |
Refseq ORF | 858 |
Synonyms | CAPPA1; CAPZ; CAZ1 |
Summary | CAPZA1 is a member of the F-actin capping protein alpha subunit family. This gene encodes the alpha subunit of the barbed-end actin binding protein. The protein regulates growth of the actin filament by capping the barbed end of growing actin filaments. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401848 | CAPZA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401848 | Transient overexpression lysate of capping protein (actin filament) muscle Z-line, alpha 1 (CAPZA1) |
CNY 3,080.00 |
|
PH301642 | CAPZA1 MS Standard C13 and N15-labeled recombinant protein (NP_006126) |
CNY 19,520.00 |