PAGE5 (NM_130467) Human Recombinant Protein
CAT#: TP303636
Purified recombinant protein of Homo sapiens P antigen family, member 5 (prostate associated) (PAGE5), transcript variant 1, 20 µg
View other "PAGE5" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203636 protein sequence
Red=Cloning site Green=Tags(s) MQAPWAGNRGWAGTREEVRDMSEHVTRSQSSERGNDQESSQPVGPVIVQQPTEEKRQEEEPPTDNQGIAP SGEIKNEGAPAVQGTDVEAFQQELALLKIEDAPGDGPDVREGTLPTFDPTKVLEAGEGQL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 13.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_569734 |
Locus ID | 90737 |
UniProt ID | Q96GU1 |
Refseq Size | 760 |
Cytogenetics | Xp11.21 |
Refseq ORF | 390 |
Synonyms | CT16; CT16.1; CT16.2; GAGEE1; PAGE-5 |
Summary | This gene is a member of family of proteins that are expressed in a variety of tumors and in some fetal and reproductive tissues. The encoded protein may protect cells from programmed cell death. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found. [provided by RefSeq, Jan 2015] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408917 | PAGE5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY408917 | Transient overexpression lysate of P antigen family, member 5 (prostate associated) (PAGE5), transcript variant 1 |
CNY 3,080.00 |
|
PH303636 | PAGE5 MS Standard C13 and N15-labeled recombinant protein (NP_569734) |
CNY 14,250.00 |