S100A16 (NM_080388) Human Recombinant Protein
CAT#: TP303879
Purified recombinant protein of Homo sapiens S100 calcium binding protein A16 (S100A16), 20 µg
View other "S100A16" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203879 representing NM_080388
Red=Cloning site Green=Tags(s) MSDCYTELEKAVIVLVENFYKYVSKYSLVKNKISKSSFREMLQKELNHMLSDTGNRKAADKLIQNLDANH DGRISFDEYWTLIGGITGPIAKLIHEQEQQSSS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 11.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_525127 |
Locus ID | 140576 |
UniProt ID | Q96FQ6 |
Refseq Size | 1085 |
Cytogenetics | 1q21.3 |
Refseq ORF | 309 |
Synonyms | AAG13; DT1P1A7; S100F |
Summary | Calcium-binding protein. Binds one calcium ion per monomer (PubMed:17030513). Can promote differentiation of adipocytes (in vitro) (By similarity). Overexpression in preadipocytes increases their proliferation, enhances adipogenesis and reduces insulin-stimulated glucose uptake (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409181 | S100A16 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY409181 | Transient overexpression lysate of S100 calcium binding protein A16 (S100A16) |
CNY 3,080.00 |
|
PH303879 | S100A16 MS Standard C13 and N15-labeled recombinant protein (NP_525127) |
CNY 14,250.00 |
其它S100A16产品