EBAG9 (NM_004215) Human Recombinant Protein
CAT#: TP305364
Recombinant protein of human estrogen receptor binding site associated, antigen, 9 (EBAG9), transcript variant 1, 20 µg
View other "EBAG9" proteins (9)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205364 protein sequence
Red=Cloning site Green=Tags(s) MAITQFRLFKFCTCLATVFSFLKRLICRSGRGRKLSGDQITLPTTVDYSSVPKQTDVEEWTSWDEDAPTS VKIEGGNGNVATQQNSLEQLEPDYFKDMTPTIRKTQKIVIKKREPLNFGIPDGSTGFSSRLAATQDLPFI HQSSELGDLDTWQENTNAWEEEEDAAWQAEEVLRQQKLADREKRAAEQQRKKMEKEAQRLMKKEQNKIGV KLS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 24.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_004206 |
Locus ID | 9166 |
UniProt ID | O00559 |
Refseq Size | 2495 |
Cytogenetics | 8q23.2 |
Refseq ORF | 639 |
Synonyms | EB9; PDAF |
Summary | This gene was identified as an estrogen-responsive gene. Regulation of transcription by estrogen is mediated by estrogen receptor, which binds to the estrogen-responsive element found in the 5'-flanking region of this gene. The encoded protein is a tumor-associated antigen that is expressed at high frequency in a variety of cancers. Alternate splicing results in multiple transcript variants. A pseudogene of this gene has been defined on chromosome 10. [provided by RefSeq, Jul 2013] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405069 | EBAG9 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC418143 | EBAG9 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC430709 | EBAG9 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY405069 | Transient overexpression lysate of estrogen receptor binding site associated, antigen, 9 (EBAG9), transcript variant 2 |
CNY 3,080.00 |
|
LY418143 | Transient overexpression lysate of estrogen receptor binding site associated, antigen, 9 (EBAG9), transcript variant 1 |
CNY 3,080.00 |
|
LY430709 | Transient overexpression lysate of estrogen receptor binding site associated, antigen, 9 (EBAG9), transcript variant 2 |
CNY 3,080.00 |
|
PH305364 | EBAG9 MS Standard C13 and N15-labeled recombinant protein (NP_004206) |
CNY 19,520.00 |
|
PH315667 | EBAG9 MS Standard C13 and N15-labeled recombinant protein (NP_936056) |
CNY 19,520.00 |
|
TP315667 | Recombinant protein of human estrogen receptor binding site associated, antigen, 9 (EBAG9), transcript variant 2, 20 µg |
CNY 2,900.00 |