CECR1 (NM_017424) Human Recombinant Protein
CAT#: TP308252
Recombinant protein of human cat eye syndrome chromosome region, candidate 1 (CECR1), transcript variant 1, 20 µg
View other "CECR1" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC208252 protein sequence
Red=Cloning site Green=Tags(s) MLVDGPSERPALCFLLLAVAMSFFGSALSIDETRAHLLLKEKMMRLGGRLVLNTKEELANERLMTLKIAE MKEAMRTLIFPPSMHFFQAKHLIERSQVFNILRMMPKGAALHLHDIGIVTMDWLVRNVTYRPHCHICFTP RGIMQFRFAHPTPRPSEKCSKWILLEDYRKRVQNVTEFDDSLLRNFTLVTQHPEVIYTNQNVVWSKFETI FFTISGLIHYAPVFRDYVFRSMQEFYEDNVLYMEIRARLLPVYELSGEHHDEEWSVKTYQEVAQKFVETH PEFIGIKIIYSDHRSKDVAVIAESIRMAMGLRIKFPTVVAGFDLVGHEDTGHSLHDYKEALMIPAKDGVK LPYFFHAGETDWQGTSIDRNILDALMLNTTRIGHGFALSKHPALRTYSWKKDIPIEVCPISNQVLKLVSD LRNHPVATLMATGHPMVISSDDPAMFGAKGLSYDFYEVFMGIGGMKADLRTLKQLAMNSIKYSTLLESEK NTFMEIWKKRWDKFIADVATK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 55.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_059120 |
Locus ID | 51816 |
UniProt ID | Q9NZK5 |
Refseq Size | 3947 |
Cytogenetics | 22q11.1 |
Refseq ORF | 1533 |
Synonyms | ADA2; ADGF; IDGFL |
Summary | This gene encodes a member of a subfamily of the adenosine deaminase protein family. The encoded protein is one of two adenosine deaminases found in humans, which regulate levels of the signaling molecule, adenosine. The encoded protein is secreted from monocytes undergoing differentiation and may regulate cell proliferation and differentiation. This gene may be responsible for some of the phenotypic features associated with cat eye syndrome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2013] |
Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406155 | CECR1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC413782 | CECR1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY406155 | Transient overexpression lysate of cat eye syndrome chromosome region, candidate 1 (CECR1), transcript variant 2 |
CNY 3,080.00 |
|
LY413782 | Transient overexpression lysate of cat eye syndrome chromosome region, candidate 1 (CECR1), transcript variant 1 |
CNY 3,080.00 |
|
PH308252 | CECR1 MS Standard C13 and N15-labeled recombinant protein (NP_059120) |
CNY 19,520.00 |