ENSA (NM_207168) Human Recombinant Protein
CAT#: TP309655
Recombinant protein of human endosulfine alpha (ENSA), transcript variant 8, 20 µg
View other "ENSA" proteins (9)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC209655 protein sequence
Red=Cloning site Green=Tags(s) MSQKQEEENPAEETGEEKQDTQEKEGILPERAEEAKLKAKYPSLGQKPGGSDFLMKRLQKGVWGIVSYPL SLELKEVLRMKSVEVLLDPFLEVLLLNRSRGEFEI myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 11.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_997051 |
Locus ID | 2029 |
UniProt ID | O43768 |
Refseq Size | 771 |
Cytogenetics | 1q21.3 |
Refseq ORF | 315 |
Synonyms | ARPP-19e |
Summary | The protein encoded by this gene belongs to a highly conserved cAMP-regulated phosphoprotein (ARPP) family. This protein was identified as an endogenous ligand for the sulfonylurea receptor, ABCC8/SUR1. ABCC8 is the regulatory subunit of the ATP-sensitive potassium (KATP) channel, which is located on the plasma membrane of pancreatic beta cells and plays a key role in the control of insulin release from pancreatic beta cells. This protein is thought to be an endogenous regulator of KATP channels. In vitro studies have demonstrated that this protein modulates insulin secretion through the interaction with KATP channel, and this gene has been proposed as a candidate gene for type 2 diabetes. At least eight alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404060 | ENSA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC404105 | ENSA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC417988 | ENSA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY404060 | Transient overexpression lysate of endosulfine alpha (ENSA), transcript variant 8 |
CNY 3,080.00 |
|
LY404105 | Transient overexpression lysate of endosulfine alpha (ENSA), transcript variant 1 |
CNY 3,080.00 |
|
LY417988 | Transient overexpression lysate of endosulfine alpha (ENSA), transcript variant 3 |
CNY 3,080.00 |
|
PH309655 | ENSA MS Standard C13 and N15-labeled recombinant protein (NP_997051) |
CNY 19,520.00 |
|
PH320441 | ENSA MS Standard C13 and N15-labeled recombinant protein (NP_996925) |
CNY 19,520.00 |
|
TP320441 | Recombinant protein of human endosulfine alpha (ENSA), transcript variant 1, 20 µg |
CNY 2,900.00 |