C4orf33 (NM_001099783) Human Recombinant Protein
CAT#: TP316543
Recombinant protein of human chromosome 4 open reading frame 33 (C4orf33), transcript variant 2, 20 µg
View other "C4orf33" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC216543 representing NM_001099783
Red=Cloning site Green=Tags(s) MDFKIEHTWDGFPVKHEPVFIRLNPGDRGVMMDISAPFFRDPPAPLGEPGKPFNELWDYEVVEAFFLNDI TEQYLEVELCPHGQHLVLLLSGRRNVWKQELPLSFRMSRGETKWEGKAYLPWSYFPPNVTKFNSFAIHGS KDKRSYEALYPVPQHELQQGQKPDFHCLEYFKSFNFNTLLGEEWKQPESDLWLIEKCDI myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 23.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001093253 |
Locus ID | 132321 |
UniProt ID | Q8N1A6 |
Refseq Size | 1601 |
Cytogenetics | 4q28.2 |
Refseq ORF | 597 |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406603 | C4orf33 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC420533 | C4orf33 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY406603 | Transient overexpression lysate of chromosome 4 open reading frame 33 (C4orf33), transcript variant 1 |
CNY 3,080.00 |
|
LY420533 | Transient overexpression lysate of chromosome 4 open reading frame 33 (C4orf33), transcript variant 2 |
CNY 3,080.00 |
|
PH307633 | C4orf33 MS Standard C13 and N15-labeled recombinant protein (NP_775758) |
CNY 19,520.00 |
|
PH316543 | C4orf33 MS Standard C13 and N15-labeled recombinant protein (NP_001093253) |
CNY 19,520.00 |
|
TP307633 | Recombinant protein of human chromosome 4 open reading frame 33 (C4orf33), transcript variant 1, 20 µg |
CNY 2,900.00 |
其它C4orf33产品