VMO1 (NM_182566) Human Recombinant Protein
CAT#: TP321753
Purified recombinant protein of Homo sapiens vitelline membrane outer layer 1 homolog (chicken) (VMO1), transcript variant 1, 20 µg
View other "VMO1" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC221753 protein sequence
Red=Cloning site Green=Tags(s) MERGAGAKLLPLLLLLRATGFTCAQTDGRNGYTAVIEVTSGGPWGDWAWPEMCPDGFFASGFSLKVEPPQ GIPGDDTALNGIRLHCARGNVLGNTHVVESQSGSWGEWSEPLWCRGGAYLVAFSLRVEAPTTLGDNTAAN NVRFRCSDGEELQGPGLSWGDFGDWSDHCPKGACGLQTKIQGPRGLGDDTALNDARLFCCRS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 21.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_872372 |
Locus ID | 284013 |
UniProt ID | Q7Z5L0 |
Refseq Size | 785 |
Cytogenetics | 17p13.2 |
Refseq ORF | 606 |
Synonyms | ERGA6350; PRO21055 |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405488 | VMO1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY405488 | Transient overexpression lysate of vitelline membrane outer layer 1 homolog (chicken) (VMO1), transcript variant 1 |
CNY 3,080.00 |
|
PH321753 | VMO1 MS Standard C13 and N15-labeled recombinant protein (NP_872372) |
CNY 14,250.00 |
|
TP720495 | Recombinant protein of human vitelline membrane outer layer 1 homolog (chicken) (VMO1), transcript variant 3 |
CNY 3,140.00 |