United States
Germany
Japan
United Kingdom
China
WTAP (NM_152857) Human Recombinant Protein
CAT＃: TP323046
Recombinant protein of human Wilms tumor 1 associated protein (WTAP), transcript variant 2, 20 µg
View other "WTAP" proteins (13)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Product images
CNY 1,999.00
CNY 2,700.00
CNY 600.00
CNY 1,050.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC223046 representing NM_152857
Red=Cloning site Green=Tags(s) MTNEEPLPKKVRLSETDFKVMARDELILRWKQYEAYVQALEGKYTDLNSNDVTGLRESEEKLKQQQQESA RRENILVMRLATKEQEMQECTTQIQYLKQVQQPSVAQLRSTMVDPAINLFFLKMKGELEQTKDKLEQAQN ELSAWKFTPDR myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 17.6 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_690596 |
| Locus ID | 9589 |
| UniProt ID | Q15007 |
| Refseq Size | 1644 |
| Cytogenetics | 6q25.3 |
| Refseq ORF | 453 |
| Synonyms | Mum2 |
| Summary | The Wilms tumor suppressor gene WT1 appears to play a role in both transcriptional and posttranscriptional regulation of certain cellular genes. This gene encodes a WT1-associating protein, which is a ubiquitously expressed nuclear protein. Like WT1 protein, this protein is localized throughout the nucleoplasm as well as in speckles and partially colocalizes with splicing factors. Alternative splicing of this gene results in several transcript variants encoding three different isoforms. [provided by RefSeq, Jul 2012] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC407186 | WTAP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC407187 | WTAP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC417661 | WTAP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC430230 | WTAP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY407186 | Transient overexpression lysate of Wilms tumor 1 associated protein (WTAP), transcript variant 2 |
CNY 3,080.00 |
|
| LY407187 | Transient overexpression lysate of Wilms tumor 1 associated protein (WTAP), transcript variant 3 |
CNY 3,080.00 |
|
| LY417661 | Transient overexpression lysate of Wilms tumor 1 associated protein (WTAP), transcript variant 1 |
CNY 3,080.00 |
|
| LY430230 | Transient overexpression lysate of Wilms tumor 1 associated protein (WTAP), transcript variant 3 |
CNY 3,080.00 |
|
| PH309632 | WTAP MS Standard C13 and N15-labeled recombinant protein (NP_004897) |
CNY 19,520.00 |
|
| PH323046 | WTAP MS Standard C13 and N15-labeled recombinant protein (NP_690596) |
CNY 19,520.00 |
|
| PH323099 | WTAP MS Standard C13 and N15-labeled recombinant protein (NP_690597) |
CNY 19,520.00 |
|
| TP309632 | Recombinant protein of human Wilms tumor 1 associated protein (WTAP), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP323099 | Recombinant protein of human Wilms tumor 1 associated protein (WTAP), transcript variant 3, 20 µg |
CNY 2,900.00 |
