Fxyd6 (BC042579) Mouse Recombinant Protein
CAT#: TP500248
Purified recombinant protein of Mouse FXYD domain-containing ion transport regulator 6 (cDNA clone MGC:25545 IMAGE:3709336), complete cds, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 7,106.00
货期*
4周
规格
Product images
经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
CNY 600.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR200248 protein sequence
Red=Cloning site Green=Tags(s) METVLVLCSLLAPVVLASAAEKEKEKDPFYYDYQTLRIGGLVFAVVLFSVGILLILSRRCKCSFNQKPRA PGDEEAQVENLITTNAAEPQKAEN myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 10.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
Locus ID | 59095 |
UniProt ID | Q9D164 |
Refseq Size | 1600 |
Cytogenetics | 9 A5.2 |
Refseq ORF | 282 |
Synonyms | 0610030I18Rik; Php |
Summary | This reference sequence was derived from multiple replicate ESTs and validated by similar human genomic sequence. This gene encodes a member of a family of small membrane proteins that share a 35-amino acid signature sequence domain, beginning with the sequence PFXYD and containing 7 invariant and 6 highly conserved amino acids. The approved human gene nomenclature for the family is FXYD-domain containing ion transport regulator. Transmembrane topology has been established for two family members (FXYD1 and FXYD2), with the N-terminus extracellular and the C-terminus on the cytoplasmic side of the membrane. FXYD2, also known as the gamma subunit of the Na,K-ATPase, regulates the properties of that enzyme. FXYD1 (phospholemman), FXYD2 (gamma), FXYD3 (MAT-8), FXYD4 (CHIF), and FXYD5 (RIC) have been shown to induce channel activity in experimental expression systems. This gene product, Fxyd6, is novel and has not been characterized as a protein. [RefSeq curation by Kathleen J. Sweadner, Ph.D., sweadner@helix.mgh.harvard.edu., Jul 2006] |
Documents
FAQs |
SDS |
You may also need
Customer
Reviews
Loading...