Pglyrp1 (BC005582) Mouse Recombinant Protein
CAT#: TP501655
Purified recombinant protein of Mouse peptidoglycan recognition protein 1 (cDNA clone MGC:11430 IMAGE:3969014), complete cds, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Product images
CNY 600.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR201655 protein sequence
Red=Cloning site Green=Tags(s) MLFACALLALLGLATSCSFIVPRSEWRALPSECSSRLGHPVRYVVISHTAGSFCNSPDSCEQQARNVQHY HKNELGWCDVAYNFLIGEDGHVYEGRGWNIKGDHTGPIWNPMSIGITFMGNFMDRVPAKRALRAALNLLE CGVSRGFLRSNYEVKGHRDVQSTLSPGDQLYQVIQSWEHYRE myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 20.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
Locus ID | 21946 |
UniProt ID | O88593 |
Refseq Size | 713 |
Cytogenetics | 7 A3 |
Refseq ORF | 546 |
Synonyms | Pglyrp, PGRP, Tag7, PGRP-S |
Summary | Pattern receptor that binds to murein peptidoglycans (PGN) of Gram-positive bacteria. Has bactericidal activity towards Gram-positive bacteria. May kill Gram-positive bacteria by interfering with peptidoglycan biosynthesis. Binds also to Gram-negative bacteria. Involved in innate immunity. May function in intracellular killing of bacteria. The soluble form triggers apoptosis in vitro.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
其它Pglyrp1产品