Ubtd1 (NM_145500) Mouse Recombinant Protein
CAT#: TP502702
Purified recombinant protein of Mouse ubiquitin domain containing 1 (Ubtd1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR202702 protein sequence
Red=Cloning site Green=Tags(s) MGNCVGRQRRERPAAPGHPRKRAGRNEPLKKERLKWKSDYPMTDGQLRSKRDEFWDTAPAFEGRKEIWDA LKAAAYAAEANDHELAQAILDGASITLPHGTLCECYDELGNRYQLPIYCLSPPVNLLLEHTEEESLEPPE PTPSVRREFPLKVRLSTGKDVRLNASLPDTVGQLKRQLHSQEGIEPSWQRWFFSGKLLTDRTRLQETKIQ KDFVIQVIINQPPPPQD myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 26 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_663475 |
Locus ID | 226122 |
UniProt ID | Q91WB7 |
Refseq Size | 1527 |
Cytogenetics | 19 C3 |
Refseq ORF | 684 |
Synonyms | BC016129 |
Summary | May be involved in the regulation of cellular senescence through a positive feedback loop with TP53. Is a TP53 downstream target gene that increases the stability of TP53 protein by promoting the ubiquitination and degradation of MDM2.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |