Emc10 (NM_197991) Mouse Recombinant Protein
CAT#: TP503345
Purified recombinant protein of Mouse ER membrane protein complex subunit 10 (Emc10), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 7,106.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR203345 protein sequence
Red=Cloning site Green=Tags(s) MVAAGAGVTRLLVLLLMVAAAPSRARGSGCRVGASARGTGADGREAEGCGTVALLLEHSFELGDGANFQK RGSLLWNQQDGTLSATQRQLSEEERGRLRDVAAVNGLYRVRVPRRPGTLDGSEAGGHVSSFVPACSLVES HLSDQLTLHVDVAGNVVGLSVVVYPGGCRGSEVEDEDLELFNTSVQLRPPSTAPGPETAAFIERLEMEQA QKAKNPQEQKSFFAKYWMYIIPVVLFLMMSGAPDAGGQGGGGGGGSSR myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 27 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_932108 |
Locus ID | 69683 |
UniProt ID | Q3TAS6, A0A0X1KG67 |
Refseq Size | 1855 |
Cytogenetics | 7 B3 |
Refseq ORF | 777 |
Synonyms | 2310044H10Rik; 5430410O10Rik; Inm02; Mirta22 |
Summary | Promotes angiogenesis and tissue repair in the heart after myocardial infarction. Stimulates cardiac endothelial cell migration and outgrowth via the activation of p38 MAPK, PAK and MAPK2 signaling pathways.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |