Pef1 (NM_026441) Mouse Recombinant Protein
CAT#: TP503692
Purified recombinant protein of Mouse penta-EF hand domain containing 1 (Pef1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR203692 protein sequence
Red=Cloning site Green=Tags(s) MASYPNGQSCPGAAGQVPGVPPGGYYPGPPHGGGQYGSGLPPGGGYGAPAPGGPYGYPSAGGVPSGTPSG PYGGIPPGGPYGQLPPGGPYGTQPGHYGQGGVPPNVDPEAYSWFQSVDADHSGYISLKELKQALVNSNWS SFNDETCHMMINMFDKTKSGRIDVAGFSALWKFLQQWRNLFQQYDRDRSGSISSTELQQALSQMGYNLSP QFTQLLVSRYCARSAIPAMQLDCFIKVCTQLQVLTEAFREKDTAVQGNIRLSFEDFVTMTASRML myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 29.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_080717 |
Locus ID | 67898 |
UniProt ID | Q8BFY6 |
Refseq Size | 1551 |
Cytogenetics | 4 D2.2 |
Refseq ORF | 828 |
Synonyms | 2600002E23Rik; Peflin |
Summary | Calcium-binding protein that acts as an adapter that bridges unrelated proteins or stabilizes weak protein-protein complexes in response to calcium. Together with PDCD6, acts as calcium-dependent adapter for the BCR(KLHL12) complex, a complex involved in endoplasmic reticulum (ER)-Golgi transport by regulating the size of COPII coats. In response to cytosolic calcium increase, the heterodimer formed with PDCD6 interacts with, and bridges together the BCR(KLHL12) complex and SEC31 (SEC31A or SEC31B), promoting monoubiquitination of SEC31 and subsequent collagen export, which is required for neural crest specification. Its role in the heterodimer formed with PDCD6 is however unclear: some evidence shows that PEF1 and PDCD6 work together and promote association between PDCD6 and SEC31 in presence of calcium. Other reports show that PEF1 dissociates from PDCD6 in presence of calcium, and may act as a negative regulator of PDCD6 (By similarity). Also acts as a negative regulator of ER-Golgi transport; possibly by inhibiting interaction between PDCD6 and SEC31 (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |