Dohh (NM_133964) Mouse Recombinant Protein
CAT#: TP504226
Purified recombinant protein of Mouse deoxyhypusine hydroxylase/monooxygenase (Dohh), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 7,106.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR204226 protein sequence
Red=Cloning site Green=Tags(s) MVTEQEIEAIGKTLVDPKQPLQARFRALFTLRGLGGPDAISWISRGFEDSSALLKHELAYCLGQMRDVRA IPVLVGVLQDTSQEPMVRHEAGEALGAIGNPEVLGLLKQYSTDPVVEVAETCQLAVGRLEWLQQHPGEAT CAGPYLSVDPAPPAAEQDVGRLREALLDEARPLFERYRAMFALRNVGGKEAALALAEGLQCGSALFRHEV GYVLGQLQHEAAVPGLAATLARTTESPMVRHECAEALGAIARPACLAALREHIEDPEQVVRESCEVALDM YEYESSQDFQYADGLERLRPPP myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 32.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_598725 |
Locus ID | 102115 |
UniProt ID | Q99LN9 |
Refseq Size | 1455 |
Cytogenetics | 10 C1 |
Refseq ORF | 909 |
Synonyms | 1110033C18Rik; AI585913; AL022869; Hlrc1 |
Summary | Catalyzes the hydroxylation of the N(6)-(4-aminobutyl)-L-lysine intermediate produced by deoxyhypusine synthase/DHPS on a critical lysine of the eukaryotic translation initiation factor 5A/eIF-5A. This is the second step of the post-translational modification of that lysine into an unusual amino acid residue named hypusine. Hypusination is unique to mature eIF-5A factor and is essential for its function.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |