Gorasp1 (NM_028976) Mouse Recombinant Protein

CAT#: TP507123

Purified recombinant protein of Mouse golgi reassembly stacking protein 1 (Gorasp1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR207123 protein sequence
Red=Cloning site Green=Tags(s)

MGLGASSEQPAGGEGFHLHGVQENSPAQQAGLEPYFDFIITIGHSRLNKENDTLKALLKANVEKPVKLEV
FNMKTMKVREVEVVPSNMWGGQGLLGASVRFCSFRRASEHVWHVLDVEPSSPAALAGLCPYTDYIVGSDQ
ILQESEDFFTLIESHEGKPLKLMVYNSESDSCREVTVTPNAAWGGEGSLGCGIGYGYLHRIPTQPSSQHK
KPPGATPPGTPATTSQLTAFPLGAPPPWPIPQDSSGPELGSRQSDFMEALPQVPGSFMEGQLLGPGSPSH
GAADCGGCLRAMEIPLQPPPPVQRVMDPGFLDVSGMSLLDSSNISVCPSLSSSTVLTSTAVSVSGPEDIG
SSSSSHERGGEATWSGSEFEISFPDSPGAQAQADHLPRLTLPDGLTSAASPEEGLSAELLEAQTEEPADT
ASLDCRAETEGRASQAQATPDPEPGL

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 46.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_083252
Locus ID 74498
UniProt ID Q91X51
Refseq Size 3483
Cytogenetics 9 F4
Refseq ORF 1341
Synonyms 5430411C10Rik; GOLPH5; GRASP65; P65
Summary Plays an important role in assembly and membrane stacking of the Golgi cisternae, and in the reassembly of Golgi stacks after breakdown during mitosis. Key structural protein required for the maintenance of the Golgi apparatus integrity: its caspase-mediated cleavage is required for fragmentation of the Golgi during apoptosis (By similarity). Also mediates, via its interaction with GOLGA2/GM130, the docking of transport vesicles with the Golgi membranes (By similarity). Mediates ER stress-induced unconventional (ER/Golgi-independent) trafficking of core-glycosylated CFTR to cell membrane (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...