Stard10 (NM_019990) Mouse Recombinant Protein

CAT#: TP519329

Purified recombinant protein of Mouse START domain containing 10 (Stard10), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1,050.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR219329 protein sequence
Red=Cloning site Green=Tags(s)

MEKPAASTEPQGSRPALGRESVQVPDDQDFRSFRSECEAEVGWNLTYSKAGVSVWVQAVEMDRTLHKIKC
RMECCDVPAETLYDVLHDIEYRKKWDSNVIETFDIARLTVNADVGYYSWRCPKPLKNRDVITLRSWLPMG
ADYIIMNYSVKHPKYPPRKDLVRAVSIQTGYLIQSTGPKSCVITYLAQVDPKGSLPKWVVNKSSQFLAPK
AMKKMYKACIKYPEWKQKHQPHFKPWLHPEQSPLPSLALSELSVQHADSLENIDESAVTESREERAGGAG
GEGSDDDTSLT

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 33 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_064374
Locus ID 56018
UniProt ID Q9JMD3
Refseq Size 1198
Cytogenetics 7 E2
Refseq ORF 876
Synonyms AV048538; CGI-52; NY-C0-28; PC-TP2; PCTP2; Pctpl; Sdccag28; SdccagG28; TISP-81
Summary Phospholipid transfer protein that preferentially selects lipid species containing a palmitoyl or stearoyl chain on the sn-1 and an unsaturated fatty acyl chain (18:1 or 18:2) on the sn-2 position. Able to transfer phosphatidylcholine (PC) and phosphatidyetanolamline (PE) between membranes (By similarity). May play metabolic roles in sperm maturation or fertilization.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...