Pth2 (NM_053256) Mouse Recombinant Protein
CAT#: TP519795
Purified recombinant protein of Mouse parathyroid hormone 2 (Pth2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR219795 representing NM_053256
Red=Cloning site Green=Tags(s) METCQMSRSPRERLLLLLLLLLLVPWGTGPASGVALPLAGVFSLRAPGRAWAGLGSPLSRRSLALADDAA FRERARLLAALERRRWLDSYMQKLLLLDAP myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 11.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_444486 |
Locus ID | 114640 |
UniProt ID | Q91W27 |
Refseq Size | 569 |
Cytogenetics | 7 B3 |
Refseq ORF | 300 |
Synonyms | Tifp; Tifp39; TIP; Tip39 |
Summary | This gene encodes the precursor of a peptide hormone that shares sequence similarity with the parathyroid hormone. This gene is expressed in various regions of the brain where it plays a role in the release of pituitary hormones, anxiety and nociception. The encoded precursor protein is proteolytically processed to generate the biologically active neuropeptide. Mice lacking the encoded protein display increased fear and anxiety after exposure to stressful events, and decreased sensitivity to pain. [provided by RefSeq, Aug 2015] |
Documents
FAQs |
SDS |