Ube2c (NM_026785) Mouse Recombinant Protein
CAT#: TP523758
Purified recombinant protein of Mouse ubiquitin-conjugating enzyme E2C (Ube2c), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 7,106.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR223758 protein sequence
Red=Cloning site Green=Tags(s) MASQNRDPAAASVAAVRKGAEPCGGAARGPVGKRLQQELMILMTSGDKGISAFPESDNLFKWVGTIHGAA GTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNICLDILKDKWSALYDVRTILLSIQSLLG EPNIDSPLNTHAAELWKNPTAFKKYLQETYSKQVSSQDP myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 19.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_081061 |
Locus ID | 68612 |
UniProt ID | Q9D1C1, A2A4Z0 |
Refseq Size | 931 |
Cytogenetics | 2 85.27 cM |
Refseq ORF | 540 |
Synonyms | 1110015A16Rik; D2Ertd695e |
Summary | Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-11'- and 'Lys-48'-linked polyubiquitination. Acts as an essential factor of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated ubiquitin ligase that controls progression through mitosis. Acts by initiating 'Lys-11'-linked polyubiquitin chains on APC/C substrates, leading to the degradation of APC/C substrates by the proteasome and promoting mitotic exit.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |