Tgif1 (NM_001164075) Mouse Recombinant Protein
CAT#: TP524610
Purified recombinant protein of Mouse TGFB-induced factor homeobox 1 (Tgif1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 7,106.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR224610 representing NM_001164075
Red=Cloning site Green=Tags(s) MEMVLSPRAGRHDPASGFRQRVEGRVISAPRPRVVELEGLVAASGSDSEDEDSMDSPLDLSSSAASGKRR RRGNLPKESVQILRDWLYEHRYNAYPSEQEKALLSQQTHLSTLQVCNWFINARRRLLPDMLRKDGKDPNQ FTISRRGAKISEASSIEAAMGIKNFMPTLEESPFHSCVVGPNPTLGRPVSPKPPSPGSILARPSVICHTT VTALKDGPFSLCQPIGVGQSTDVPQIAPSNFTDTSLVYPEDTCKSGPSPNPQSGLFNTPPPTPPDLNQDF SGFQLLVDVALKRAAEMELQAKLTA myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 33.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001157547 |
Locus ID | 21815 |
UniProt ID | G3UWC5 |
Refseq Size | 1720 |
Cytogenetics | 17 E1.3 |
Refseq ORF | 915 |
Synonyms | AA959811; AI462167; Tgif |
Summary | Binds to a retinoid X receptor (RXR) responsive element from the cellular retinol-binding protein II promoter (CRBPII-RXRE). Inhibits the 9-cis-retinoic acid-dependent RXR alpha transcription activation of the retinoic acid responsive element. May participate in the transmission of nuclear signals during development and in the adult, as illustrated by the down-modulation of the RXR alpha activities (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |