HAGH Rabbit Polyclonal Antibody

CAT#: TA334982

Rabbit Polyclonal Anti-HAGH Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5,250.00


货期*
6周

规格
    • 100 ul

Product images

经常一起买 (4)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human hydroxyacylglutathione hydrolase (HAGH), transcript variant 1, 20 µg
    • 20 ug

CNY 2,900.00
CNY 6,650.00


Transient overexpression lysate of hydroxyacylglutathione hydrolase (HAGH), nuclear gene encoding mitochondrial protein, transcript variant 1
    • 100 ug

CNY 3,080.00


Transient overexpression lysate of hydroxyacylglutathione hydrolase (HAGH), nuclear gene encoding mitochondrial protein, transcript variant 2
    • 100 ug

CNY 3,080.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-HAGH antibody: synthetic peptide directed towards the C terminal of human HAGH. Synthetic peptide located within the following region: FARHVEPGNAAIREKLAWAKEKYSIGEPTVPSTLAEEFTYNPFMRVREKT
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 29 kDa
Gene Name hydroxyacylglutathione hydrolase
Background HAGH is classified as a thiolesterase and is responsible for the hydrolysis of S-lactoyl-glutathione to reduced glutathione and D-lactate. The enzyme encoded by this gene is classified as a thiolesterase and is responsible for the hydrolysis of S-lactoyl-glutathione to reduced glutathione and D-lactate.
Synonyms GLO2; GLX2; GLXII; HAGH1
Note Immunogen Sequence Homology: Dog: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Mouse: 93%; Pig: 86%; Rat: 86%; Guinea pig: 86%; Zebrafish: 79%
Reference Data
Protein Families Druggable Genome
Protein Pathways Pyruvate metabolism
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...