Sphingosine 1 phosphate phosphatase 2 (SGPP2) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-SGPP2 antibody: synthetic peptide directed towards the C terminal of human SGPP2. Synthetic peptide located within the following region: SKPAESLPVIQNIPPLTTYMLVLGLTKFAVGIVLILLVRQLVQNLSLQVL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	37 kDa
Gene Name	sphingosine-1-phosphate phosphatase 2
Database Link	NP_689599 Entrez Gene 130367 Human UniProt ID Q8IWX5
Background	Sphingosine-1-phosphate (S1P) is a bioactive sphingolipid metabolite that regulates diverse biologic processes. SGPP2 catalyzes the degradation of S1P (Ogawa et al., 2003 [PubMed 12411432]). [supplied by OMIM, Jun 2009]. ##Evidence-Data-START## Transcript exon combination :: BC134342.1, AF542512.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025081, ERS025082 [ECO:0000348] ##Evidence-Data-END##
Synonyms	SPP2; SPPase2
Note	Immunogen Sequence Homology: Human: 100%; Bovine: 93%; Rabbit: 93%; Pig: 86%; Horse: 86%; Mouse: 86%; Guinea pig: 86%; Rat: 85%
Reference Data
Protein Families	Transmembrane
Protein Pathways	Sphingolipid metabolism

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.