PPP2R5C Rabbit Polyclonal Antibody

CAT#: TA344611

Rabbit Polyclonal Anti-PPP2R5C Antibody - middle region



Need it in bulk or conjugated?
Get a free quote

CNY 4,628.00


货期*
2周

规格
    • 50 ug

Product images

经常一起买 (4)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Purified recombinant protein of Homo sapiens protein phosphatase 2, regulatory subunit B', gamma isoform (PPP2R5C), transcript variant 1, 20 µg
    • 20 ug

CNY 2,900.00
CNY 6,650.00


Transient overexpression lysate of protein phosphatase 2, regulatory subunit B', gamma (PPP2R5C), transcript variant 6
    • 100 ug

CNY 3,080.00


Transient overexpression lysate of protein phosphatase 2, regulatory subunit B', gamma isoform (PPP2R5C), transcript variant 4
    • 100 ug

CNY 3,080.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-PPP2R5C antibody: synthetic peptide directed towards the middle region of human PPP2R5C. Synthetic peptide located within the following region: RFLESPDFQPNIAKKYIDQKFVLQLLELFDSEDPRERDFLKTTLHRIYGK
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 45 kDa
Gene Name protein phosphatase 2 regulatory subunit B'gamma
Background The product of this gene belongs to the phosphatase 2A regulatory subunit B family. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common het
Synonyms B56G; MGC23064; PR61G
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Yeast: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%
Reference Data
Protein Families Druggable Genome, Phosphatase
Protein Pathways Oocyte meiosis, Wnt signaling pathway
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...