ZNF280C Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ZNF280C antibody: synthetic peptide directed towards the N terminal of human ZNF280C. Synthetic peptide located within the following region: DDDKPFQPKNISKMAELFMECEEEELEPWQKKVEETQDEDDDELIFVGEI
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	83 kDa
Gene Name	zinc finger protein 280C
Database Link	NP_060136 Entrez Gene 55609 Human UniProt ID Q8ND82
Background	ZNF280C contains 5 C2H2-type zinc fingers. It may function as a transcription factor.
Synonyms	SUHW3; ZNF633
Note	Immunogen Sequence Homology: Human: 100%; Rabbit: 92%; Dog: 83%; Pig: 79%; Horse: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.