S100 calcium binding protein A14 (S100A14) (NM_020672) Human Tagged ORF Clone

CAT#: RG202590

  • TrueORF®

S100A14 (tGFP-tagged) - Human S100 calcium binding protein A14 (S100A14)

ORF Plasmid: DDK tGFP



  "NM_020672" in other vectors (6)

Need custom modification / cloning service?
Get a free quote

CNY 2,800.00

CNY 4,370.00


货期*
现货

规格
    • 10 ug

Cited in 1 publication.

Product images

经常一起买 (5)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

CNY 6,080.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

CNY 1,000.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


S100A14 mouse monoclonal antibody, clone OTI2G9 (formerly 2G9)
    • 100 ul

CNY 1,999.00
CNY 2,700.00

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Synonyms BCMP84; S100A15
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG202590 representing NM_020672
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGACAGTGTCGGTCAGCCAACGCAGAGGATGCTCAGGAATTCAGTGATGTGGAGAGGGCCATTGAGA
CCCTCATCAAGAACTTTCACCAGTACTCCGTGGAGGGTGGGAAGGAGACGCTGACCCCTTCTGAGCTACG
GGACCTGGTCACCCAGCAGCTGCCCCATCTCATGCCGAGCAACTGTGGCCTGGAAGAGAAAATTGCCAAC
CTGGGCAGCTGCAATGACTCTAAACTGGAGTTCAGGAGTTTCTGGGAGCTGATTGGAGAAGCGGCCAAGA
GTGTGAAGCTGGAGAGGCCTGTCCGGGGGCAC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG202590 representing NM_020672
Red=Cloning site Green=Tags(s)

MGQCRSANAEDAQEFSDVERAIETLIKNFHQYSVEGGKETLTPSELRDLVTQQLPHLMPSNCGLEEKIAN
LGSCNDSKLEFRSFWELIGEAAKSVKLERPVRGH

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_020672
ORF Size 312 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_020672.3
RefSeq Size 1057 bp
RefSeq ORF 315 bp
Locus ID 57402
UniProt ID Q9HCY8
Domains S_100
Gene Summary This gene encodes a member of the S100 protein family which contains an EF-hand motif and binds calcium. The gene is located in a cluster of S100 genes on chromosome 1. Levels of the encoded protein have been found to be lower in cancerous tissue and associated with metastasis suggesting a tumor suppressor function (PMID: 19956863, 19351828). [provided by RefSeq, Dec 2011]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)

Other Versions

其它S100 calcium binding protein A14产品

Customer Reviews 
Loading...