United States
Germany
Japan
United Kingdom
China
CD20 (MS4A1) (NM_021950) Human Mass Spec Standard
CAT＃: PH301242
MS4A1 MS Standard C13 and N15-labeled recombinant protein (NP_068769)
View other "CD20" proteins (8)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
CNY 1,999.00
CNY 2,700.00
CNY 3,080.00
Specifications
| Product Data | |
| Description | MS4A1 MS Standard C13 and N15-labeled recombinant protein (NP_068769) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC201242 |
| Predicted MW | 33.1 kDa |
| Protein Sequence |
>RC201242 protein sequence
Red=Cloning site Green=Tags(s) MTTPRNSVNGTFPAEPMKGPIAMQSGPKPLFRRMSSLVGPTQSFFMRESKTLGAVQIMNGLFHIALGGLL MIPAGIYAPICVTVWYPLWGGIMYIISGSLLAATEKNSRKCLVKGKMIMNSLSLFAAISGMILSIMDILN IKISHFLKMESLNFIRAHTPYINIYNCEPANPSEKNSPSTQYCYSIQSLFLGILSVMLIFAFFQELVIAG IVENEWKRTCSRPKSNIVLLSAEEKKEQTIEIKEEVVGLTETSSQPKNEEDIEIIPIQEEEEEETETNFP EPPQDQESSPIENDSSP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_068769 |
| RefSeq Size | 3331 |
| RefSeq ORF | 891 |
| Synonyms | B1; Bp35; CD20; CVID5; FMC7; LEU-16; MS4A2; S7 |
| Locus ID | 931 |
| Cytogenetics | 11q12.2 |
| Summary | This gene encodes a member of the membrane-spanning 4A gene family. Members of this nascent protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues. This gene encodes a B-lymphocyte surface molecule which plays a role in the development and differentiation of B-cells into plasma cells. This family member is localized to 11q12, among a cluster of family members. Alternative splicing of this gene results in two transcript variants which encode the same protein. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Transmembrane |
| Protein Pathways | Hematopoietic cell lineage |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402889 | MS4A1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC407182 | MS4A1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402889 | Transient overexpression lysate of membrane-spanning 4-domains, subfamily A, member 1 (MS4A1), transcript variant 3 |
CNY 3,080.00 |
|
| LY407182 | Transient overexpression lysate of membrane-spanning 4-domains, subfamily A, member 1 (MS4A1), transcript variant 1 |
CNY 3,080.00 |
|
| TP301242 | Recombinant protein of human membrane-spanning 4-domains, subfamily A, member 1 (MS4A1), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
| TP721275 | PE Conjugated Human CD20 Protein (TrxA tag) |
CNY 3,480.00 |
|
| TP721276 | APC Conjugated Human CD20 Protein (TrxA tag) |
CNY 3,480.00 |
|
| TP790190 | Purified recombinant protein of Human membrane-spanning 4-domains, subfamily A, member 1 (MS4A1), transcript variant 3, Ile141-Ser188, with N-terminal TrxA tag, expressed in E.coli, 50ug |
CNY 1,948.00 |
