Pancreatic Polypeptide (PPY) (NM_002722) Human Mass Spec Standard
CAT#: PH306584
PPY MS Standard C13 and N15-labeled recombinant protein (NP_002713)
View other "Pancreatic Polypeptide" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 14,250.00
Cited in 1 publication. |
CNY 1,999.00
CNY 3,490.00
Specifications
Product Data | |
Description | PPY MS Standard C13 and N15-labeled recombinant protein (NP_002713) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC206584 |
Predicted MW | 10.4 kDa |
Protein Sequence |
>RC206584 protein sequence
Red=Cloning site Green=Tags(s) MAAARLCLSLLLLSTCVALLLQPLLGAQGAPLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRYGKRHK EDTLAFSEWGSPHAAVPRELSPLDL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_002713 |
RefSeq Size | 457 |
RefSeq ORF | 285 |
Synonyms | PNP; PP |
Locus ID | 5539 |
Cytogenetics | 17q21.31 |
Summary | This gene encodes a member of the neuropeptide Y (NPY) family of peptides. The encoded 95 aa preproprotein is synthesized in the pancreatic islets of Langerhans and proteolytically processed to generate two peptide products. These products include the active pancreatic hormone of 36 aa and an icosapeptide of unknown function. This hormone acts as a regulator of pancreatic and gastrointestinal functions and may be important in the regulation of food intake. Plasma level of this hormone has been shown to be reduced in conditions associated with increased food intake and elevated in anorexia nervosa. In addition, infusion of this hormone in obese rodents has shown to decrease weight gain. Alternative splicing results in multiple transcript variants, at least one of which encodes an isoform that is proteolytically processed. [provided by RefSeq, Jan 2016] |
Protein Families | Secreted Protein |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Loss of the transcriptional repressor TGIF1 results in enhanced Kras-driven development of pancreatic cancer
,null,
Molecular Cancer
,PubMed ID 31109321
[PPY]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
TP306584 | Purified recombinant protein of Homo sapiens pancreatic polypeptide (PPY), 20 µg |
CNY 2,900.00 |
|
TP721220 | Purified recombinant protein of Human pancreatic polypeptide (PPY) |
CNY 5,460.00 |
|
TP762154 | Purified recombinant protein of Human pancreatic polypeptide (PPY),Ala30-Arg88, N-terminal His-PDCD1(Pro21-Val170) tag, expressed in E. coli, 50ug |
CNY 1,948.00 |
其它Pancreatic Polypeptide产品