Pancreatic Polypeptide (PPY) (NM_002722) Human Mass Spec Standard

Specifications

Product Data
Description	PPY MS Standard C13 and N15-labeled recombinant protein (NP_002713)
Species	Human
Expression Host	HEK293
Expression cDNA Clone or AA Sequence	RC206584
Predicted MW	10.4 kDa
Protein Sequence	Sequence Link (showhide) >RC206584 protein sequence Red=Cloning site Green=Tags(s) MAAARLCLSLLLLSTCVALLLQPLLGAQGAPLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRYGKRHK EDTLAFSEWGSPHAAVPRELSPLDL myc-FLAG tag
Tag	C-Myc/DDK
Purity	> 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration	>0.05 µg/µL as determined by microplate BCA method
Labeling Method	Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer	25 mM Tris-HCl, 100 mM glycine, pH 7.3
Reference Data
RefSeq	NP_002713
RefSeq Size	457
RefSeq ORF	285
Synonyms	PNP; PP
Locus ID	5539
Cytogenetics	17q21.31
Summary	This gene encodes a member of the neuropeptide Y (NPY) family of peptides. The encoded 95 aa preproprotein is synthesized in the pancreatic islets of Langerhans and proteolytically processed to generate two peptide products. These products include the active pancreatic hormone of 36 aa and an icosapeptide of unknown function. This hormone acts as a regulator of pancreatic and gastrointestinal functions and may be important in the regulation of food intake. Plasma level of this hormone has been shown to be reduced in conditions associated with increased food intake and elevated in anorexia nervosa. In addition, infusion of this hormone in obese rodents has shown to decrease weight gain. Alternative splicing results in multiple transcript variants, at least one of which encodes an isoform that is proteolytically processed. [provided by RefSeq, Jan 2016]
Protein Families	Secreted Protein

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.