United States
Germany
Japan
United Kingdom
China
VPS28 (NM_183057) Human Mass Spec Standard
CAT＃: PH308726
VPS28 MS Standard C13 and N15-labeled recombinant protein (NP_898880)
View other "VPS28" proteins (8)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
| Product Data | |
| Description | VPS28 MS Standard C13 and N15-labeled recombinant protein (NP_898880) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC208726 |
| Predicted MW | 26.5 kDa |
| Protein Sequence |
>RC208726 protein sequence
Red=Cloning site Green=Tags(s) MFHGIPATPGIGAPGNKPELYEEVKLYKNAREREKYDNMAELFAVVKTMQALEKAYIKDCVSPSEYTAAC SRLLVQYKAAFRQVQGSEISSIDEFCRKFRLDCPLAMERIKEDRPITIKDDKGNLNRCIADVVSLFITVM DKLRLEIRAMDEIQPDLRELMETMHRMSHLPPDFEGRQTVSQWWVSLPARQSPAVPETLPARRSPAVPLR PSAPTCPVLHSQAADPERHVGVR myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_898880 |
| RefSeq Size | 1112 |
| RefSeq ORF | 699 |
| Locus ID | 51160 |
| Cytogenetics | 8q24.3 |
| Summary | This gene encodes a protein subunit of the ESCRT-I complex (endosomal complexes required for transport), which functions in the transport and sorting of proteins into subcellular vesicles. This complex can also be hijacked to facilitate the budding of enveloped viruses from the cell membrane. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2013] |
| Protein Pathways | Endocytosis |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC405220 | VPS28 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC414122 | VPS28 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY405220 | Transient overexpression lysate of vacuolar protein sorting 28 homolog (S. cerevisiae) (VPS28), transcript variant 2 |
CNY 3,080.00 |
|
| LY414122 | Transient overexpression lysate of vacuolar protein sorting 28 homolog (S. cerevisiae) (VPS28), transcript variant 1 |
CNY 3,080.00 |
|
| PH300025 | VPS28 MS Standard C13 and N15-labeled recombinant protein (NP_057292) |
CNY 19,520.00 |
|
| TP300025 | Recombinant protein of human vacuolar protein sorting 28 homolog (S. cerevisiae) (VPS28), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP308726 | Recombinant protein of human vacuolar protein sorting 28 homolog (S. cerevisiae) (VPS28), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP761364 | Purified recombinant protein of Human vacuolar protein sorting 28 homolog (S. cerevisiae) (VPS28), transcript variant 1, full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug |
CNY 2,040.00 |
