DNMT3L (NM_175867) Human Mass Spec Standard
CAT#: PH319008
DNMT3L MS Standard C13 and N15-labeled recombinant protein (NP_787063)
View other "DNMT3L" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | DNMT3L MS Standard C13 and N15-labeled recombinant protein (NP_787063) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC219008 |
Predicted MW | 43.5 kDa |
Protein Sequence |
>RC219008 protein sequence
Red=Cloning site Green=Tags(s) MAAIPALDPEAEPSMDVILVGSSELSSSVSPGTGRDLIAYEVKANQRNIEDICICCGSLQVHTQHPLFEG GICAPCKDKFLDALFLYDDDGYQSYCSICCSGETLLICGNPDCTRCYCFECVDSLVGPGTSGKVHAMSNW VCYLCLPSSRSGLLQRRRKWRSQLKAFYDRESENPLEMFETVPVWRRQPVRVLSLFEDIKKELTSLGFLE SGSDPGQLKHVVDVTDTVRKDVEEWGPFDLVYGATPPLGHTCDRPPSWYLFQFHRLLQYARPKPGSPGPF FWMFVDNLVLNKEDLDVASRFLEMEPVTIPDVHGGSLQNAVRVWSNIPAIRSRHWALVSEEELSLLAQNK QSSKLAAKWPTKLVKNCFLPLREYFKYFSTELTSSL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_787063 |
RefSeq Size | 1720 |
RefSeq ORF | 1158 |
Locus ID | 29947 |
Cytogenetics | 21q22.3 |
Summary | CpG methylation is an epigenetic modification that is important for embryonic development, imprinting, and X-chromosome inactivation. Studies in mice have demonstrated that DNA methylation is required for mammalian development. This gene encodes a nuclear protein with similarity to DNA methyltransferases, but is not thought to function as a DNA methyltransferase as it does not contain the amino acid residues necessary for methyltransferase activity. However, it does stimulate de novo methylation by DNA cytosine methyltransferase 3 alpha and is thought to be required for the establishment of maternal genomic imprints. This protein also mediates transcriptional repression through interaction with histone deacetylase 1. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2012] |
Protein Families | Druggable Genome, Transcription Factors |
Protein Pathways | Cysteine and methionine metabolism, Metabolic pathways |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402250 | DNMT3L HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC406188 | DNMT3L HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402250 | Transient overexpression lysate of DNA (cytosine-5-)-methyltransferase 3-like (DNMT3L), transcript variant 1 |
CNY 3,080.00 |
|
LY406188 | Transient overexpression lysate of DNA (cytosine-5-)-methyltransferase 3-like (DNMT3L), transcript variant 2 |
CNY 3,080.00 |
|
TP319008 | Recombinant protein of human DNA (cytosine-5-)-methyltransferase 3-like (DNMT3L), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP710295 | Purified recombinant protein of Human DNA (cytosine-5-)-methyltransferase 3-like (DNMT3L), transcript variant 1, full length, with C-terminal DDK tag, expressed in sf9, 20ug |
CNY 4,020.00 |
|
TP761810 | Purified recombinant protein of Human DNA (cytosine-5-)-methyltransferase 3-like (DNMT3L), transcript variant 1, full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug |
CNY 2,040.00 |