HMGB2 (NM_002129) Human Recombinant Protein
CAT#: TP300750
Recombinant protein of human high-mobility group box 2 (HMGB2), transcript variant 1, 20 µg
View other "HMGB2" proteins (9)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200750 protein sequence
Red=Cloning site Green=Tags(s) MGKGDPNKPRGKMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDMAKSDKAR YDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKD KQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPGRPTGSKKKNEPEDEEEEEEEEDEDEEEEDEDEE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 23.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_002120 |
Locus ID | 3148 |
UniProt ID | P26583 |
Refseq Size | 1527 |
Cytogenetics | 4q34.1 |
Refseq ORF | 627 |
Synonyms | HMG2 |
Summary | This gene encodes a member of the non-histone chromosomal high mobility group protein family. The proteins of this family are chromatin-associated and ubiquitously distributed in the nucleus of higher eukaryotic cells. In vitro studies have demonstrated that this protein is able to efficiently bend DNA and form DNA circles. These studies suggest a role in facilitating cooperative interactions between cis-acting proteins by promoting DNA flexibility. This protein was also reported to be involved in the final ligation step in DNA end-joining processes of DNA double-strand breaks repair and V(D)J recombination. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419515 | HMGB2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427242 | HMGB2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427243 | HMGB2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419515 | Transient overexpression lysate of high-mobility group box 2 (HMGB2), transcript variant 1 |
CNY 3,080.00 |
|
LY427242 | Transient overexpression lysate of high-mobility group box 2 (HMGB2), transcript variant 2 |
CNY 3,080.00 |
|
LY427243 | Transient overexpression lysate of high-mobility group box 2 (HMGB2), transcript variant 3 |
CNY 3,080.00 |
|
PH300750 | HMGB2 MS Standard C13 and N15-labeled recombinant protein (NP_002120) |
CNY 19,520.00 |
|
TP720732 | Purified recombinant protein of Human high mobility group box 2 (HMGB2), transcript variant 1 |
CNY 5,460.00 |
|
TP760625 | Purified recombinant protein of Human high mobility group box 2 (HMGB2), transcript variant 3, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2,040.00 |