United States
Germany
Japan
United Kingdom
China
ZNF580 (NM_207115) Human Recombinant Protein
CAT＃: TP304398
Recombinant protein of human zinc finger protein 580 (ZNF580), transcript variant 2, 20 µg
View other "ZNF580" proteins (10)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC204398 protein sequence
Red=Cloning site Green=Tags(s) MLLLPPRPPHPRSSSPEAMDPPPPKAPPFPKAEGPSSTPSSAAGPRPPRLGRHLLIDANGVPYTYTVQLE EEPRGPPQREAPPGEPGPRKGYSCPECARVFASPLRLQSHRVSHSDLKPFTCGACGKAFKRSSHLSRHRA THRARAGPPHTCPLCPRRFQDAAELAQHVRLH myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 18.6 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_996998 |
| Locus ID | 51157 |
| UniProt ID | Q9UK33 |
| Refseq Size | 1152 |
| Cytogenetics | 19q13.42 |
| Refseq ORF | 516 |
| Summary | Involved in the regulation of endothelial cell proliferation and migration. Mediates H(2)O(2)-induced leukocyte chemotaxis by elevating interleukin-8 production and may play a role in inflammation. May be involved in transcriptional regulation.[UniProtKB/Swiss-Prot Function] |
| Protein Families | Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC404118 | ZNF580 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC414134 | ZNF580 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC431774 | ZNF580 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY404118 | Transient overexpression lysate of zinc finger protein 580 (ZNF580), transcript variant 2 |
CNY 3,080.00 |
|
| LY414134 | Transient overexpression lysate of zinc finger protein 580 (ZNF580), transcript variant 1 |
CNY 3,080.00 |
|
| LY431774 | Transient overexpression lysate of zinc finger protein 580 (ZNF580), transcript variant 3 |
CNY 3,080.00 |
|
| PH304398 | ZNF580 MS Standard C13 and N15-labeled recombinant protein (NP_996998) |
CNY 19,520.00 |
|
| PH314316 | ZNF580 MS Standard C13 and N15-labeled recombinant protein (NP_057286) |
CNY 19,520.00 |
|
| TP314316 | Recombinant protein of human zinc finger protein 580 (ZNF580), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP328746 | Recombinant protein of human zinc finger protein 580 (ZNF580), transcript variant 3, 20 µg |
CNY 2,900.00 |
