PRPH2 (NM_000322) Human Recombinant Protein
CAT#: TP310357
Recombinant protein of human peripherin 2 (retinal degeneration, slow) (PRPH2), 20 µg
View other "PRPH2" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC210357 protein sequence
Red=Cloning site Green=Tags(s) MALLKVKFDQKKRVKLAQGLWLMNWFSVLAGIIIFSLGLFLKIGLRKRSDVMNNSESHFVPNSLIGMGVL SCVFNSLAGKICYDALDPAKYARWKPWLKPYLAICVLFNIILFLVALCCFLLRGSLENTLGQGLKNGMKY YRDTDTPGRCFMKKTIDMLQIEFKCCGNNGFRDWFEIQWISNRYLDFSSKEVKDRIKSNVDGRYLVDGVP FSCCNPSSPRPCIQYQITNNSAHYSYDHQTEELNLWVRGCRAALLSYYSSLMNSMGVVTLLIWLFEVTIT IGLRYLQTSLDGVSNPEESESESEGWLLEKSVPETWKAFLESVKKLGKGNQVEAEGAGAGQAPEAG myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 39.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_000313 |
Locus ID | 5961 |
UniProt ID | P23942 |
Refseq Size | 3027 |
Cytogenetics | 6p21.1 |
Refseq ORF | 1038 |
Synonyms | AOFMD; AVMD; CACD2; DS; MDBS1; PRPH; rd2; RDS; RP7; TSPAN22 |
Summary | The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein found in the outer segment of both rod and cone photoreceptor cells. It may function as an adhesion molecule involved in stabilization and compaction of outer segment disks or in the maintenance of the curvature of the rim. This protein is essential for disk morphogenesis. Defects in this gene are associated with both central and peripheral retinal degenerations. Some of the various phenotypically different disorders are autosomal dominant retinitis pigmentosa, progressive macular degeneration, macular dystrophy and retinitis pigmentosa digenic. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Amyotrophic lateral sclerosis (ALS) |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400122 | PRPH2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400122 | Transient overexpression lysate of peripherin 2 (retinal degeneration, slow) (PRPH2) |
CNY 3,080.00 |
|
PH310357 | PRPH2 MS Standard C13 and N15-labeled recombinant protein (NP_000313) |
CNY 19,520.00 |