Nectin 2 (NECTIN2) (NM_001042724) Human Recombinant Protein
CAT#: TP313693
Recombinant protein of human poliovirus receptor-related 2 (herpesvirus entry mediator B) (PVRL2), transcript variant delta, 20 µg
View other "Nectin 2" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC213693 representing NM_001042724
Red=Cloning site Green=Tags(s) MARAAALLPSRSPPTPLLWPLLLLLLLETGAQDVRVQVLPEVRGQLGGTVELPCHLLPPVPGLYISLVTW QRPDAPANHQNVAAFHPKMGPSFPSPKPGSERLSFVSAKQSTGQDTEAELQDATLALHGLTVEDEGNYTC EFATFPKGSVRGMTWLRVIAKPKNQAEAQKVTFSQDPTTVALCISKEGRPPARISWLSSLDWEAKETQVS GTLAGTVTVTSRFTLVPSGRADGVTVTCKVEHESFEEPALIPVTLSVRYPPEVSISGYDDNWYLGRTDAT LSCDVRSNPEPTGYDWSTTSGTFPTSAVAQGSQLVIHAVDSLFNTTFVCTVTNAVGMGRAEQVIFVRETP NTAGAGATGGIIGGIIAAIIATAVAATGILICRQQRKEQTLQGAEEDEDLEGPPSYKPPTPKAKLEAQEM PSQLFTLGASEHSPLKTPYFDAGASCTEQEMPRYHELPTLEERSGPLHPGATSLGSPIPVPPGPPAVEDV SLDLEDEEGEEEEEYLDKINPIYDALSYSSPSDSYQGKGFVMSRAMYV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 54.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001036189 |
Locus ID | 5819 |
UniProt ID | Q92692 |
Refseq Size | 2869 |
Cytogenetics | 19q13.32 |
Refseq ORF | 1614 |
Synonyms | CD112; HVEB; PRR2; PVRL2; PVRR2 |
Summary | This gene encodes a single-pass type I membrane glycoprotein with two Ig-like C2-type domains and an Ig-like V-type domain. This protein is one of the plasma membrane components of adherens junctions. It also serves as an entry for certain mutant strains of herpes simplex virus and pseudorabies virus, and it is involved in cell to cell spreading of these viruses. Variations in this gene have been associated with differences in the severity of multiple sclerosis. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Adherens junction, Cell adhesion molecules (CAMs) |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419084 | PVRL2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC429120 | PVRL2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419084 | Transient overexpression lysate of poliovirus receptor-related 2 (herpesvirus entry mediator B) (PVRL2), transcript variant alpha |
CNY 3,080.00 |
|
PH313693 | PVRL2 MS Standard C13 and N15-labeled recombinant protein (NP_001036189) |
CNY 19,520.00 |
|
TP720371 | Recombinant protein of human poliovirus receptor-related 2 (herpesvirus entry mediator B) (PVRL2), transcript variant delta |
CNY 4,060.00 |
其它Nectin 2产品