PYCR1 (NM_153824) Human Recombinant Protein
CAT#: TP316359L
Recombinant protein of human pyrroline-5-carboxylate reductase 1 (PYCR1), transcript variant 2, 1 mg
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 36,000.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC216359 representing NM_153824
Red=Cloning site Green=Tags(s) MSVGFIGAGQLAFALAKGFTAAGVLAAHKIMASSPDMDLATVSALRKMGVKLTPHNKETVQHSDVLFLAV KPHIIPFILDEIGADIEDRHIVVSCAAGVTISSIEKKLSAFRPAPRVIRCMTNTPVVVREGATVYATGTH AQVEDGRLMEQLLSSVGFCTEVEEDLIDAVTGLSGSGPAYAFTALDALADGGVKMGLPRRLAVRLGAQAL LGAAKMLLHSEQHPGQLKDNVSSPGGATIHALHVLESGGFRSLLINAVEASCIRTRELQSMADQEQVSPA AIKKTILDKDHLPLELGSPEGLHPLLLQYQLARAPS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 33.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_722546 |
Locus ID | 5831 |
UniProt ID | P32322, Q8TBX0 |
Refseq Size | 1768 |
Cytogenetics | 17q25.3 |
Refseq ORF | 948 |
Synonyms | ARCL2B; ARCL3B; P5C; P5CR; PIG45; PP222; PRO3; PYCR |
Summary | This gene encodes an enzyme that catalyzes the NAD(P)H-dependent conversion of pyrroline-5-carboxylate to proline. This enzyme may also play a physiologic role in the generation of NADP(+) in some cell types. The protein forms a homopolymer and localizes to the mitochondrion. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2013] |
Protein Pathways | Arginine and proline metabolism, Metabolic pathways |
Documents
FAQs |
SDS |