F3 (NM_010171) Mouse Recombinant Protein
CAT#: TP504046
Purified recombinant protein of Mouse coagulation factor III (F3), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 7,106.00
Product images
CNY 600.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR204046 protein sequence
Red=Cloning site Green=Tags(s) MAILVRPRLLAALAPTFLGCLLLQVIAGAGIPEKAFNLTWISTDFKTILEWQPKPTNYTYTVQISDRSRN WKNKCFSTTDTECDLTDEIVKDVTWAYEAKVLSVPRRNSVHGDGDQLVIHGEEPPFTNAPKFLPYRDTNL GQPVIQQFEQDGRKLNVVVKDSLTLVRKNGTFLTLRQVFGKDLGYIITYRKGSSTGKKTNITNTNEFSID VEEGVSYCFFVQAMIFSRKTNQNSPGSSTVCTEQWKSFLGETLIIVGAVVLLATIFIILLSISLCKRRKN RAGQKGKNTPSRLA myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 32.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_034301 |
Locus ID | 14066 |
UniProt ID | P20352, A0A0R4J088 |
Refseq Size | 1876 |
Cytogenetics | 3 52.94 cM |
Refseq ORF | 885 |
Synonyms | AA409063; CD142; Cf-3; Cf3; TF |
Summary | This gene encodes a membrane-bound glycoprotein that forms the primary physiological initiator of the blood coagulation process following vascular damage. The encoded protein binds to coagulation factor VIIa and the ensuing complex catalyzes the proteolytic activation of coagulation factors IX and X. Mice lacking encoded protein die in utero resulting from massive hemorrhaging in both extraembryonic and embryonic vessels. A severe deficiency of the encoded protein in mice results in impaired uterine homeostasis, shorter life spans due to spontaneous fatal hemorrhages and cardiac fibrosis. [provided by RefSeq, Aug 2015] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
PH303142 | F3 MS Standard C13 and N15-labeled recombinant protein (NP_001984) |
CNY 19,520.00 |
|
TP303142 | Recombinant protein of human coagulation factor III (thromboplastin, tissue factor) (F3), 20 µg |
CNY 2,900.00 |
|
TP720578 | Recombinant protein of Homo sapien Tissue Factor/TF is produced by our mammalian expression system in human cells. The target protein is expressed with human TF fused with a polyhistidine tag at the C-terminus. |
CNY 5,460.00 |