Krt19 (NM_008471) Mouse Recombinant Protein

CAT#: TP506318

Purified recombinant protein of Mouse keratin 19 (Krt19), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 7,106.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR206318 protein sequence
Red=Cloning site Green=Tags(s)

MTSYSYRQTSAMSSFGGTGGGSVRIGSGGVFRAPSIHGGSGGRGVSVSSTRFVTSSSGSYGGVRGGSFSG
TLAVSDGLLSGNEKITMQNLNDRLASYLDKVRALEQANGELEVKIRDWYQKQGPGPSRDYNHYFKTIEDL
RDKILGATIDNSKIVLQIDNARLAADDFRTKFETEHALRLSVEADINGLRRVLDELTLARTDLEMQIESL
KEELAYLKKNHEEEITALRSQVGGQVSVEVDSTPGVDLAKILSEMRSQYEIMAEKNRKDAEATYLARIEE
LNTQVAVHSEQIQISKTEVTDLRRTLQGLEIELQSQLSMKAALEGTLAETEARYGVQLSQIQSVISGFEA
QLSDVRADIERQNQEYKQLMDIKSRLEQEIATYRSLLEGQEAHYNNLPTPKAI

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 44.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_032497
Locus ID 16669
UniProt ID P19001, B1AQ78
Refseq Size 1509
Cytogenetics 11 63.42 cM
Refseq ORF 1212
Synonyms AI663979; CK-19; End; EndoC; K19; Krt-1.1; Krt-1.19; Krt1-1; Krt1-19
Summary The protein encoded by this gene is a member of the keratin family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. The type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains. Unlike its related family members, this smallest known acidic cytokeratin is not paired with a basic cytokeratin in epithelial cells. It is specifically expressed in the periderm, the transiently superficial layer that envelopes the developing epidermis. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2015]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...