Dnal1 (NM_028821) Mouse Recombinant Protein

CAT#: TP516479

Purified recombinant protein of Mouse dynein, axonemal, light chain 1 (Dnal1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 7,106.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR216479 representing NM_028821
Red=Cloning site Green=Tags(s)

MAKATTIKEALSRWEEKTGQKPSDAKEIKLYAQIPPIEKMDASLSTLGNCEKLSLSTNCIEKIANLNGLK
NLRILSLGRNNIKNLNGLEAVGETLEELWISYNFIEKLKGIHVMKKLKILYMSNNLVKDWAEFLKLAELP
CLEDLVFVGNPLEEKHSAEGNWIDEATKRVPKLKKLDGTPVIKEDEEEES

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 21.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_083097
Locus ID 105000
UniProt ID Q05A62
Refseq Size 5792
Cytogenetics 12 D1
Refseq ORF 570
Synonyms 1700010H15Rik; AW121714; Dnalc1; E330027P08Rik
Summary Part of the multisubunit axonemal ATPase complexes that generate the force for cilia motility and govern beat frequency (By similarity). Component of the outer arm dynein (ODA). May be involved in a mechanosensory feedback mechanism controlling ODA activity based on external conformational cues by tethering the outer arm dynein heavy chain (DNAH5) to the microtubule within the axoneme (By similarity). Important for ciliary function in the airways and for the function of the cilia that produce the nodal flow essential for the determination of the left-right asymmetry (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...