Il17a (NM_010552) Mouse Recombinant Protein
CAT#: TP527682
Purified recombinant protein of Mouse interleukin 17A (Il17a), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
View other "Il17a" proteins (1)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 7,106.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR227682 protein sequence
Red=Cloning site Green=Tags(s) MSPGRASSVSLMLLLLLSLAATVKAAAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYL NRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEK MLVGVGCTCVASIVRQAA myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 17.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_034682 |
Locus ID | 16171 |
UniProt ID | Q62386, Q544E6 |
Refseq Size | 1171 |
Cytogenetics | 1 A4 |
Refseq ORF | 477 |
Synonyms | Ctl; Ctla; Ctla-8; Ctla8; Il; IL-; IL-17; IL-17A; Il17 |
Summary | This gene encodes a pro-inflammatory cytokine that is a member of the interleukin-17 family. The encoded protein plays a central role in host defense against diverse pathogens. The encoded protein is produced by activated T-cells and certain cell types of innate immune system. The active protein functions as either a homodimer with other interleukin-17 family members and signals through the interleukin-17 receptor to induce inflammatory cytokine production. Aberrant expression of this gene is associated with autoinflammatory diseases including rheumatoid arthritis, psoriasis and multiple sclerosis. [provided by RefSeq, Sep 2015] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
TP723750 | Purified recombinant protein of Mouse interleukin 17A (Il17a) |
CNY 4,090.00 |