SLC41A2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-SLC41A2 Antibody: synthetic peptide directed towards the N terminal of human SLC41A2. Synthetic peptide located within the following region: SCSQKYDDYANYNYCDGRETSETTAMLQDEDISSDGDEDAIVEVTPKLPK
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	53 kDa
Gene Name	solute carrier family 41 member 2
Database Link	NP_115524 Entrez Gene 84102 Human UniProt ID Q96JW4
Background	SLC41A2 acts as a plasma-membrane magnesium transporter.
Synonyms	SLC41A1-L1
Note	Immunogen sequence homology: Human: 100%; Rabbit: 100%; Horse: 86%; Dog: 79%; Bovine: 77%; Mouse: 75%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.