RNF113A Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-RNF113A Antibody is: synthetic peptide directed towards the N-terminal region of Human RNF113A. Synthetic peptide located within the following region: VVRPEKKRVTHNPMIQKTRDSGKQKAAYGDLSSEEEEENEPESLGVVYKS
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	39 kDa
Gene Name	ring finger protein 113A
Database Link	NP_008909 Entrez Gene 7737 Human UniProt ID O15541
Background	The exact function of RNF113A remains unknown.
Synonyms	Cwc24; RNF113; TTD5; ZNF183
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 92%; Rat: 85%; Mouse: 85%
Reference Data
Protein Families	Druggable Genome, Protease

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.