RNASE11 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-RNASE11 antibody: synthetic peptide directed towards the middle region of human RNASE11. Synthetic peptide located within the following region: GISCCESLELENTVCQFTTGKQFPRCQYHSVTSLEKILTVLTGHSLMSWL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	22 kDa
Gene Name	ribonuclease A family member 11 (inactive)
Database Link	NP_660293 Entrez Gene 122651 Human UniProt ID Q8TAA1
Background	RNASE11 belongs to the pancreatic ribonuclease family. The function of RNASE11 remains unknown.
Synonyms	C14orf6; HEL-S-84p; RAJ1
Note	Immunogen Sequence Homology: Human: 100%; Horse: 92%; Pig: 83%; Rabbit: 83%; Guinea pig: 83%
Reference Data
Protein Families	Secreted Protein

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.