GJA3 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-GJA3 antibody: synthetic peptide directed towards the N terminal of human GJA3. Synthetic peptide located within the following region: ISHIRFWALQIIFVSTPTLIYLGHVLHIVRMEEKKKEREEEEQLKRESPS
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	47 kDa
Gene Name	gap junction protein alpha 3
Database Link	NP_068773 Entrez Gene 2700 Human UniProt ID Q9Y6H8
Background	The protein encoded byThis gene is a connexin and is a component of lens fiber gap junctions. Defects inThis gene are a cause of zonular pulverulent cataract type 3 (CZP3). [provided by RefSeq, Jan 2010]
Synonyms	CTRCT14; CX46; CZP3
Note	Immunogen Sequence Homology: Human: 100%; Pig: 91%; Horse: 91%; Yeast: 91%; Rat: 90%; Zebrafish: 90%; Mouse: 83%
Reference Data
Protein Families	Druggable Genome, Ion Channels: Other, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.