GCAP2 (GUCA1B) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-GUCA1B antibody: synthetic peptide directed towards the N terminal of human GUCA1B. Synthetic peptide located within the following region: SGTLFMHEFKRFFKVTDDEEASQYVEGMFRAFDKNGDNTIDFLEYVAALN
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	23 kDa
Gene Name	guanylate cyclase activator 1B
Database Link	NP_002089 Entrez Gene 2979 Human UniProt ID Q9UMX6
Background	The protein encoded by this gene is a calcium-binding protein that activates photoreceptor guanylate cyclases. This gene may have arisen due to a gene duplication event since there is a highly similar gene clustered with it on chromosome 6. Mutations in this gene can cause a form of retinitis pigmentosa.
Synonyms	GCAP2; GUCA2; RP48
Note	Immunogen Sequence Homology: Human: 100%; Mouse: 86%; Dog: 79%; Pig: 79%; Rat: 79%; Horse: 79%; Bovine: 79%; Rabbit: 79%; Guinea pig: 79%
Reference Data
Protein Families	Druggable Genome
Protein Pathways	Olfactory transduction

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.