Cxxc5 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Cxxc5 antibody is synthetic peptide directed towards the N-terminal region of Mouse Cxxc5. Synthetic peptide located within the following region: MSSLGGGSQDAGGSSSSSNTNSSSGSGQKAGGTDKSTAVAATTAPTSVAD
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	33 kDa
Gene Name	CXXC finger 5
Database Link	NP_598448 Entrez Gene 67393 Mouse UniProt ID Q91WA4
Background	Cxxc5 may indirectly participate in activation of the NF-kappa-B and MAPK pathways. It acts as a mediator of BMP4-mediated modulation of canonical Wnt signaling activity in neural stem cells. Cxxc5 is also required for DNA damage-induced ATM phosphorylation, p53 activation and cell cycle arrest and is involved in myelopoiesis.
Synonyms	CF5; HSPC195; RINF
Note	Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Horse: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.