Gpx1 (NM_008160) Mouse Tagged ORF Clone
CAT#: MR202058
- TrueORF®
Gpx4 (Myc-DDK-tagged) - Mouse glutathione peroxidase 4 (cDNA clone MGC:118087 IMAGE:4936866), (10ug), (Note: selenocysteine protein, Internal stop codon present. see reference data summary below)
ORF Plasmid: tGFP
"NM_008160" in other vectors (2)
Need custom modification / cloning service?
Get a free quote
CNY 2,081.00
Cited in 1 publication. |
CNY 300.00
Specifications
Product Data | |
Type | Mouse Untagged ORF Clone |
Synonyms | AI195024; AL033363; CGP; CGPx; Gp; Gpx; GPx-; GPx-1; GSHPx; GSHPx-1 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>MR202058 representing NM_008160
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGTGTGCTGCTCGGCTCTCCGCGGCGGCACAGTCCACCGTGTATGCCTTCTCCGCGCGCCCGCTGACGG GCGGGGAGCCTGTGAGCCTGGGCTCCCTGCGGGGCAAGGTGCTGCTCATTGAGAATGTCGCGTCTCTCTG AGGCACCACGATCCGGGACTACACCGAGATGAACGATCTGCAGAAGCGTCTGGGACCTCGTGGACTGGTG GTGCTCGGTTTCCCGTGCAATCAGTTCGGACACCAGGAGAATGGCAAGAATGAAGAGATTCTGAATTCCC TCAAGTACGTCCGACCTGGTGGCGGGTTCGAGCCCAATTTTACATTGTTTGAGAAGTGCGAAGTGAATGG TGAGAAGGCTCACCCGCTCTTTACCTTCCTGCGGAATGCCTTGCCAACACCCAGTGACGACCCCACTGCG CTCATGACCGACCCCAAGTACATCATTTGGTCTCCGGTGTGCCGCAACGACATTGCCTGGAACTTTGAGA AGTTCCTGGTGGGCCCCGACGGTGTTCCCGTGCGCAGGTACAGCCGCCGCTTTCGTACCATCGACATCGA ACCTGACATAGAAACCCTGCTGTCCCAGCAGTCTGGCAACTCC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >MR202058 representing NM_008160
Red=Cloning site Green=Tags(s) MCAARLSAAAQSTVYAFSARPLTGGEPVSLGSLRGKVLLIENVASL*GTTIRDYTEMNDLQKRLGPRGLV VLGFPCNQFGHQENGKNEEILNSLKYVRPGGGFEPNFTLFEKCEVNGEKAHPLFTFLRNALPTPSDDPTA LMTDPKYIIWSPVCRNDIAWNFEKFLVGPDGVPVRRYSRRFRTIDIEPDIETLLSQQSGNS myc-FLAG tag |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_008160 |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info The expression of this clone is not guaranteed due to the nature of selenoproteins. |
OTI Annotation | This clone encodes a selenoprotein containing the rare amino acid selenocysteine (Sec). Sec is encoded by UGA codon, which normally signals translational termination. Expression of this clone is not guaranteed due to the nature of selenoproteins. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_008160.6, NP_032186.2 |
RefSeq Size | 848 bp |
RefSeq ORF | 606 bp |
Locus ID | 14775 |
UniProt ID | P11352 |
Gene Summary | The protein encoded by this gene belongs to the glutathione peroxidase family, members of which catalyze the reduction of organic hydroperoxides and hydrogen peroxide (H2O2) by glutathione, and thereby protect cells against oxidative damage. Knockout mice lacking this gene are highly sensitive to oxidants, and develop mature cataracts due to damage to the eye lens nucleus. Other studies indicate that H2O2 is also essential for growth-factor mediated signal transduction, mitochondrial function, and maintenance of thiol redox-balance; therefore, by limiting H2O2 accumulation, glutathione peroxidases are also involved in modulating these processes. Several isozymes of this gene family exist in vertebrates, which vary in cellular location and substrate specificity. This isozyme is the most abundant, is ubiquitously expressed and localized in the cytoplasm, and whose preferred substrate is hydrogen peroxide. It is also a selenoprotein, containing the rare amino acid selenocysteine (Sec) at its active site. Sec is encoded by the UGA codon, which normally signals translation termination. The 3' UTRs of selenoprotein mRNAs contain a conserved stem-loop structure, designated the Sec insertion sequence (SECIS) element, that is necessary for the recognition of UGA as a Sec codon, rather than as a stop signal. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jul 2016] |
Citations (1)
The use of this cDNA Clones has been cited in the following citations: |
---|
Mitochondrial stress induced by continuous stimulation under hypoxia rapidly drives T cell exhaustion
,Scharping, NE;Rivadeneira, DB;Menk, AV;Vignali, PDA;Ford, BR;Rittenhouse, NL;Peralta, R;Wang, Y;Wang, Y;DePeaux, K;Poholek, AC;Delgoffe, GM;,
Nature immunology
,PubMed ID 33398183
[GPX1]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
MC207295 | Gpx1 (untagged) - Mouse glutathione peroxidase 1 (Gpx1), (10ug), (Note: selenocysteine protein, Internal stop codon present. see reference data summary below) |
CNY 3,990.00 |
|
MG202058 | Gpx1 (GFP-tagged) - Mouse glutathione peroxidase 1 (Gpx1), (10ug), (Note: selenocysteine protein, Internal stop codon present. see reference data summary below) |
CNY 2,850.00 |