S100a10 (NM_009112) Mouse Tagged ORF Clone
CAT#: MR226807
- TrueORF®
S100a10 (Myc-DDK-tagged) - Mouse S100 calcium binding protein A10 (calpactin) (S100a10)
ORF Plasmid: tGFP
"NM_009112" in other vectors (4)
Need custom modification / cloning service?
Get a free quote
CNY 1,800.00
CNY 4,180.00
Cited in 3 publications. |
CNY 300.00
Specifications
Product Data | |
Type | Mouse Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | 42C; AA409961; AL024248; Cal1l; CAL12; CLP11; p10; p11 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>MR226807 representing NM_009112
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGCCATCCCAAATGGAGCACGCCATGGAAACCATGATGCTTACGTTTCACAGGTTTGCAGGCGACAAAG ACCACTTGACAAAGGAGGACCTGAGAGTGCTCATGGAACGGGAGTTCCCTGGGTTTTTGGAAAATCAAAA GGACCCTCTGGCTGTGGACAAAATAATGAAGGACCTGGACCAGTGCCGAGATGGCAAAGTGGGCTTCCAG AGCTTTCTATCACTAGTGGCAGGGCTCACCATTGCATGCAATGACTATTTTGTAGTAAACATGAAGCAGA AGGGGAAGAAG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >MR226807 representing NM_009112
Red=Cloning site Green=Tags(s) MPSQMEHAMETMMLTFHRFAGDKDHLTKEDLRVLMEREFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQ SFLSLVAGLTIACNDYFVVNMKQKGKK myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_009112 |
ORF Size | 291 bp |
OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_009112.2, NP_033138.1 |
RefSeq Size | 650 bp |
RefSeq ORF | 294 bp |
Locus ID | 20194 |
UniProt ID | P08207 |
MW | 11.6 kDa |
Gene Summary | Because S100A10 induces the dimerization of ANXA2/p36, it may function as a regulator of protein phosphorylation in that the ANXA2 monomer is the preferred target (in vitro) of tyrosine-specific kinase.[UniProtKB/Swiss-Prot Function] |
Citations (3)
The use of this cDNA Clones has been cited in the following citations: |
---|
Expression of p11 and heteromeric TASK channels in mouse adrenal cortical cells and H295R cells.
,null,
Acta histochemica
,PubMed ID 35526370
[S100a10]
|
Expression of p11 and Heteromeric TASK Channels in Rat Carotid Body Glomus Cells and Nerve Growth Factor-differentiated PC12 Cells
,Matsuoka, H;Pokorski, M;Harada, K;Yoshimura, R;Inoue, M;,
The journal of histochemistry and cytochemistry : official journal of the Histochemistry Society
,PubMed ID 32886017
[S100A10]
|
Lack of p11 expression facilitates acidity-sensing function of TASK1 channels in mouse adrenal medullary cells
,Inoue, M;Matsuoka, H;Lesage, F;Harada, K;,
FASEB J.
,PubMed ID 30001168
[S100A10]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
MC209344 | S100a10 (untagged) - Mouse S100 calcium binding protein A10 (calpactin) (S100a10), (10ug) |
CNY 3,990.00 |
|
MG226807 | S100a10 (tGFP-tagged) - Mouse S100 calcium binding protein A10 (calpactin) (S100a10), (10ug) |
CNY 3,400.00 |
|
MR226807L3 | Lenti ORF clone of S100a10 (Myc-DDK-tagged) - Mouse S100 calcium binding protein A10 (calpactin) (S100a10) |
CNY 5,890.00 |
|
MR226807L4 | Lenti ORF clone of S100a10 (mGFP-tagged) - Mouse S100 calcium binding protein A10 (calpactin) (S100a10) |
CNY 4,200.00 |
其它S100a10产品