Cldn10 (NM_001160096) Mouse Tagged ORF Clone

CAT#: MR226977

  • TrueORF®

Cldn10 (Myc-DDK-tagged) - Mouse claudin 10 (Cldn10), transcript variant a_v1

ORF Plasmid: DDK tGFP



  "NM_001160096" in other vectors (3)

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

CNY 2,090.00


货期*
3周

规格
    • 10 ug

Product images

经常一起买 (4)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Synonyms 6720456I16Rik; Cldn; Cldn1; Cldn10a; Cldn10b; D14Ertd728; D14Ertd728e
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR226977 representing NM_001160096
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCCAGGGCACAGATCTCAGCTCTGGTGTGTGGTGTTGGAGGGTTTGGTGCTCTCGTCGCTGCCACCA
CATCCAACGAATGGAAAGTGACCACCCGAGCGTCGTCTGTGATTACCGCCACCTGGGTTTACCAGGGTCT
GTGGATGAACTGCGCAGGTTACATCCAGGCATGTAGAGGACTAATGATCGCTGCGGTCAGCCTGGGATTT
TTCGGTTCCATTTTTGCACTCTTTGGAATGAAATGTACCAAAGTCGGAGGCTCAGATCAAGCCAAAGCTA
AAATTGCTTGCTTGGCCGGGATTGTATTCATATTGTCAGGTCTGTGTTCCATGACAGGCTGTTCCCTGTA
TGCAAACAAAATCACAACAGAATTCTTTGATCCTCTTTATATGGAGCAAAAGTATGAATTAGGGGCTGCT
CTCTTCATCGGATGGGCAGGAGCTTCTCTCTGCATCATTGGGGGAGTCATATTTTGCTTTTCAATATCCG
ACAACAACAAGACACCCAGAATGGGCTACACATACAACGGACCCACGTCTGCCATGTCTTCTCGGACCAA
GTATCAAGGCGGAGAAGGAGATTTTAAAACCACAGGCCCTTCAAAACAGTTTGATAAAAATGCCTATGTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR226977 representing NM_001160096
Red=Cloning site Green=Tags(s)

MSRAQISALVCGVGGFGALVAATTSNEWKVTTRASSVITATWVYQGLWMNCAGYIQACRGLMIAAVSLGF
FGSIFALFGMKCTKVGGSDQAKAKIACLAGIVFILSGLCSMTGCSLYANKITTEFFDPLYMEQKYELGAA
LFIGWAGASLCIIGGVIFCFSISDNNKTPRMGYTYNGPTSAMSSRTKYQGGEGDFKTTGPSKQFDKNAYV

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001160096
ORF Size 630 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001160096.1, NP_001153568.1
RefSeq Size 1143 bp
RefSeq ORF 633 bp
Locus ID 58187
UniProt ID Q9Z0S6
MW 22.8 kDa
Gene Summary This intronless gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight unction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining cell polarity and signal transductions. Six alternatively spliced transcript variants have been identified, which encode different isoforms with distinct electric charge of the first extracellular loop and with or without the fourth transmembrane region. These isoforms exhibit distinct localization and function in paracellular anion or cation permeability. [provided by RefSeq, Aug 2010]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...