Ascl1 (NM_008553) Mouse Tagged ORF Clone

CAT#: MR227072

  • TrueORF®

Ascl1 (Myc-DDK-tagged) - Mouse achaete-scute complex homolog 1 (Drosophila) (Ascl1)

ORF Plasmid: DDK tGFP



  "NM_008553" in other vectors (6)

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

CNY 1,416.00


货期*
现货

规格
    • 10 ug

Product images

经常一起买 (4)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Synonyms AI225900; ASH1; bHLHa46; Mash1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR227072 representing NM_008553
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGAGCTCTGGCAAGATGGAGAGTGGAGCCGGCCAGCAGCCGCAGCCCCCGCAGCCCTTCCTGCCTC
CCGCAGCCTGCTTCTTTGCGACCGCGGCGGCGGCGGCAGCGGCGGCGGCCGCGGCAGCTCAGAGCGCGCA
GCAGCAACAGCCGCAGGCGCCGCCGCAGCAGGCGCCGCAGCTGAGCCCGGTGGCCGACAGCCAGCCCTCA
GGGGGCGGTCACAAGTCAGCGGCCAAGCAGGTCAAGCGCCAGCGCTCGTCCTCTCCGGAACTGATGCGCT
GCAAACGCCGGCTCAACTTCAGCGGCTTCGGCTACAGCCTGCCACAGCAGCAGCCGGCCGCCGTGGCGCG
CCGCAACGAGCGCGAGCGCAACCGGGTCAAGTTGGTCAACCTGGGTTTTGCCACCCTCCGGGAGCATGTC
CCCAACGGCGCGGCCAACAAGAAGATGAGCAAGGTGGAGACGCTGCGCTCGGCGGTCGAGTACATCCGCG
CGCTGCAGCAGCTGCTGGACGAGCACGACGCGGTGAGCGCTGCCTTTCAGGCGGGCGTCCTGTCGCCCAC
CATCTCCCCCAACTACTCCAACGACTTGAACTCTATGGCGGGTTCTCCGGTCTCGTCCTACTCCTCCGAC
GAGGGATCCTACGACCCTCTTAGCCCAGAGGAACAAGAGCTGCTGGACTTTACCAACTGGTTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR227072 representing NM_008553
Red=Cloning site Green=Tags(s)

MESSGKMESGAGQQPQPPQPFLPPAACFFATAAAAAAAAAAAAQSAQQQQPQAPPQQAPQLSPVADSQPS
GGGHKSAAKQVKRQRSSSPELMRCKRRLNFSGFGYSLPQQQPAAVARRNERERNRVKLVNLGFATLREHV
PNGAANKKMSKVETLRSAVEYIRALQQLLDEHDAVSAAFQAGVLSPTISPNYSNDLNSMAGSPVSSYSSD
EGSYDPLSPEEQELLDFTNWF

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_008553
ORF Size 693 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_008553.5
RefSeq Size 2259 bp
RefSeq ORF 696 bp
Locus ID 17172
UniProt ID Q02067
MW 25.2 kDa
Gene Summary Transcription factor that plays a key role in neuronal differentiation: acts as a pioneer transcription factor, accessing closed chromatin to allow other factors to bind and activate neural pathways (PubMed:24243019). Directly binds the E box motif (5'-CANNTG-3') on promoters and promotes transcription of neuronal genes (PubMed:20107439, PubMed:24243019, PubMed:27281220). The combination of three transcription factors, ASCL1, POU3F2/BRN2 and MYT1L, is sufficient to reprogram fibroblasts and other somatic cells into induced neuronal (iN) cells in vitro (PubMed:20107439, PubMed:24243019, PubMed:27281220). Plays a role at early stages of development of specific neural lineages in most regions of the CNS, and of several lineages in the PNS (PubMed:8217843). Essential for the generation of olfactory and autonomic neurons (PubMed:8221886). Acts synergistically with FOXN4 to specify the identity of V2b neurons rather than V2a from bipotential p2 progenitors during spinal cord neurogenesis, probably through DLL4-NOTCH signaling activation (PubMed:16020526, PubMed:17728344).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...