PAGE4 (NM_007003) Human Tagged ORF Clone
CAT#: RC203059
PAGE4 (Myc-DDK-tagged)-Human P antigen family, member 4 (prostate associated) (PAGE4)
ORF Plasmid: tGFP
"NM_007003" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 1,200.00
CNY 3,705.00
Cited in 1 publication. |
CNY 300.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | CT16.7; GAGE-9; GAGEC1; JM-27; JM27; PAGE-1; PAGE-4 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC203059 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGAGTGCACGAGTGAGATCAAGATCCAGAGGAAGAGGAGATGGTCAGGAGGCTCCCGATGTGGTTGCAT TCGTGGCTCCCGGTGAATCTCAGCAAGAGGAACCACCAACTGACAATCAGGATATTGAACCTGGACAAGA GAGAGAAGGAACACCTCCGATCGAAGAACGTAAAGTAGAAGGTGATTGCCAGGAAATGGATCTGGAAAAG ACTCGGAGTGAGCGTGGAGATGGCTCTGATGTAAAAGAGAAGACTCCACCTAATCCTAAGCATGCTAAGA CTAAAGAAGCAGGAGATGGGCAGCCA ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC203059 protein sequence
Red=Cloning site Green=Tags(s) MSARVRSRSRGRGDGQEAPDVVAFVAPGESQQEEPPTDNQDIEPGQEREGTPPIEERKVEGDCQEMDLEK TRSERGDGSDVKEKTPPNPKHAKTKEAGDGQP myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_007003 |
ORF Size | 306 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_007003.4 |
RefSeq Size | 563 bp |
RefSeq ORF | 309 bp |
Locus ID | 9506 |
UniProt ID | O60829 |
MW | 11.2 kDa |
Gene Summary | This gene is a member of the GAGE family. The GAGE genes are expressed in a variety of tumors and in some fetal and reproductive tissues. This gene is strongly expressed in prostate and prostate cancer. It is also expressed in other male and female reproductive tissues including testis, fallopian tube, uterus, and placenta, as well as in testicular cancer and uterine cancer. The protein encoded by this gene shares sequence similarity with other GAGE/PAGE proteins, and also belongs to a family of CT (cancer-testis) antigens. The protein may play a role in benign and malignant prostate diseases. A related pseudogene is located on chromosome 7. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Jan 2016] |
Citations (1)
The use of this cDNA Clones has been cited in the following citations: |
---|
The Cancer/Testis Antigen PAGE4, a Regulator of c-Jun Transactivation, is Phosphorylated by Homeodomain-interacting Protein Kinase 1, a Component of the Stress-response Pathway
,Mooney, SM;Qiu, RR;Kim, JJ;Sacho, EJ;Rajagopalan, K;Johng, D;Shiraishi, T;Kulkarni, P;Weninger, KR;,
Biochemistry, Feb 2014.
,PubMed ID 24559171
[PAGE4]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC203059L1 | Lenti ORF clone of Human P antigen family, member 4 (prostate associated) (PAGE4), Myc-DDK-tagged |
CNY 3,600.00 |
|
RC203059L2 | Lenti ORF clone of Human P antigen family, member 4 (prostate associated) (PAGE4), mGFP tagged |
CNY 5,890.00 |
|
RC203059L3 | Lenti ORF clone of Human P antigen family, member 4 (prostate associated) (PAGE4), Myc-DDK-tagged |
CNY 5,890.00 |
|
RC203059L4 | Lenti ORF clone of Human P antigen family, member 4 (prostate associated) (PAGE4), mGFP tagged |
CNY 5,890.00 |
|
RG203059 | PAGE4 (tGFP-tagged) - Human P antigen family, member 4 (prostate associated) (PAGE4) |
CNY 2,800.00 |
|
SC128094 | PAGE4 (untagged)-Human P antigen family, member 4 (prostate associated) (PAGE4) |
CNY 1,200.00 |