DAD1 (NM_001344) Human Tagged ORF Clone

CAT#: RG200623

  • TrueORF®

DAD1 (tGFP-tagged) - Human defender against cell death 1 (DAD1)

ORF Plasmid: DDK tGFP



  "NM_001344" in other vectors (6)

Need custom modification / cloning service?
Get a free quote

CNY 4,370.00


货期*
3周

规格
    • 10 ug

Product images

经常一起买 (5)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

CNY 6,080.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

CNY 1,000.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


Rabbit Polyclonal DAD1 Antibody
    • 100 ug

CNY 5,808.00

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Synonyms OST2
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG200623 representing NM_001344
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCGGCGTCGGTAGTGTCTGTCATTTCGCGGTTCTTAGAAGAGTACTTGAGCTCCACTCCGCAGCGTC
TGAAGTTGCTGGACGCGTACCTGCTGTATATACTGCTGACCGGGGCGCTGCAGTTCGGTTACTGTCTCCT
CGTGGGGACCTTCCCCTTCAACTCTTTTCTCTCGGGCTTCATCTCTTGTGTGGGGAGTTTCATCCTAGCG
GTTTGCCTGAGAATACAGATCAACCCACAGAACAAAGCGGATTTCCAAGGCATCTCCCCAGAGCGAGCCT
TTGCTGATTTTCTCTTTGCCAGCACCATCCTGCACCTTGTTGTCATGAACTTTGTTGGC


ACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG200623 representing NM_001344
Red=Cloning site Green=Tags(s)

MSASVVSVISRFLEEYLSSTPQRLKLLDAYLLYILLTGALQFGYCLLVGTFPFNSFLSGFISCVGSFILA
VCLRIQINPQNKADFQGISPERAFADFLFASTILHLVVMNFVG

TRPLE - GFP Tag - V
Restriction Sites SgfI-NotI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001344
ORF Size 339 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001344.4
RefSeq Size 699 bp
RefSeq ORF 342 bp
Locus ID 1603
UniProt ID P61803
Domains DAD
Protein Families Druggable Genome, Transmembrane
Protein Pathways Metabolic pathways, N-Glycan biosynthesis
Gene Summary DAD1, the defender against apoptotic cell death, was initially identified as a negative regulator of programmed cell death in the temperature sensitive tsBN7 cell line. The DAD1 protein disappeared in temperature-sensitive cells following a shift to the nonpermissive temperature, suggesting that loss of the DAD1 protein triggered apoptosis. DAD1 is believed to be a tightly associated subunit of oligosaccharyltransferase both in the intact membrane and in the purified enzyme, thus reflecting the essential nature of N-linked glycosylation in eukaryotes. [provided by RefSeq, Jul 2008]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...